SCOPe 2.05: Domain d1uema_: 1uem A:

Lineage for d1uema_ (1uem A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein KIAA1568 protein [101529] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101530] (2 PDB entries)

8. Domain d1uema_: 1uem A: [99267]
   structural genomics; first Fn3 module

Details for d1uema_

PDB Entry: 1uem

PDB Description: solution structure of the first fibronectin type iii domain of human kiaa1568 protein

PDB Compounds: (A:) KIAA1568 Protein

SCOPe Domain Sequences for d1uema_:

Sequence; same for both SEQRES and ATOM records:

>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]}
gssgssgknydlsdlpgppskpqvtdvtknsvtlswqpgtpgtlpasayiieafsqsvsn
swqtvanhvkttlytvrglrpntiylfmvrainpqglsdpspmsdpvrtqdsgpssg

Timeline for d1uema_:

• d1uema_ first appeared in SCOP 1.67
  
• d1uema_ appears in SCOPe 2.04
  
• d1uema_ is called d1uema1 in SCOPe 2.06
  
• d1uema_ appears in the current release, SCOPe 2.08, called d1uema1