Lineage for d1uema_ (1uem A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 366660Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 366661Family b.1.2.1: Fibronectin type III [49266] (22 proteins)
  6. 366849Protein KIAA1568 protein [101529] (1 species)
  7. 366850Species Human (Homo sapiens) [TaxId:9606] [101530] (2 PDB entries)
  8. 366851Domain d1uema_: 1uem A: [99267]
    structural genomics; first Fn3 module

Details for d1uema_

PDB Entry: 1uem (more details)

PDB Description: solution structure of the first fibronectin type iii domain of human kiaa1568 protein

SCOP Domain Sequences for d1uema_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens)}
gssgssgknydlsdlpgppskpqvtdvtknsvtlswqpgtpgtlpasayiieafsqsvsn
swqtvanhvkttlytvrglrpntiylfmvrainpqglsdpspmsdpvrtqdsgpssg

SCOP Domain Coordinates for d1uema_:

Click to download the PDB-style file with coordinates for d1uema_.
(The format of our PDB-style files is described here.)

Timeline for d1uema_: