Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (1 family) |
Family b.1.2.1: Fibronectin type III [49266] (22 proteins) |
Protein KIAA1568 protein [101529] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101530] (2 PDB entries) |
Domain d1uema_: 1uem A: [99267] structural genomics; first Fn3 module |
PDB Entry: 1uem (more details)
SCOP Domain Sequences for d1uema_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens)} gssgssgknydlsdlpgppskpqvtdvtknsvtlswqpgtpgtlpasayiieafsqsvsn swqtvanhvkttlytvrglrpntiylfmvrainpqglsdpspmsdpvrtqdsgpssg
Timeline for d1uema_: