Lineage for d1uema1 (1uem A:8-111)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2029371Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2029372Family b.1.2.1: Fibronectin type III [49266] (45 protein domains)
    Pfam PF00041
  6. 2029730Protein KIAA1568 protein [101529] (1 species)
  7. 2029731Species Human (Homo sapiens) [TaxId:9606] [101530] (2 PDB entries)
  8. 2029732Domain d1uema1: 1uem A:8-111 [99267]
    Other proteins in same PDB: d1uema2, d1uema3
    structural genomics; first Fn3 module

Details for d1uema1

PDB Entry: 1uem (more details)

PDB Description: Solution Structure of the First Fibronectin Type III domain of human KIAA1568 Protein
PDB Compounds: (A:) KIAA1568 Protein

SCOPe Domain Sequences for d1uema1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uema1 b.1.2.1 (A:8-111) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]}
knydlsdlpgppskpqvtdvtknsvtlswqpgtpgtlpasayiieafsqsvsnswqtvan
hvkttlytvrglrpntiylfmvrainpqglsdpspmsdpvrtqd

SCOPe Domain Coordinates for d1uema1:

Click to download the PDB-style file with coordinates for d1uema1.
(The format of our PDB-style files is described here.)

Timeline for d1uema1: