SCOPe 2.08: Domain d1uema1: 1uem A:8-111

Lineage for d1uema1 (1uem A:8-111)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein KIAA1568 protein [101529] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101530] (2 PDB entries)

8. Domain d1uema1: 1uem A:8-111 [99267]
   Other proteins in same PDB: d1uema2, d1uema3
   structural genomics; first Fn3 module

Details for d1uema1

PDB Entry: 1uem

PDB Description: solution structure of the first fibronectin type iii domain of human kiaa1568 protein

PDB Compounds: (A:) KIAA1568 Protein

SCOPe Domain Sequences for d1uema1:

Sequence; same for both SEQRES and ATOM records:

>d1uema1 b.1.2.1 (A:8-111) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]}
knydlsdlpgppskpqvtdvtknsvtlswqpgtpgtlpasayiieafsqsvsnswqtvan
hvkttlytvrglrpntiylfmvrainpqglsdpspmsdpvrtqd

Timeline for d1uema1:

• d1uema1 first appeared in SCOP 1.67, called d1uema_
  
• d1uema1 appears in SCOPe 2.07