Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein KIAA1568 protein [101529] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101530] (2 PDB entries) |
Domain d1uema1: 1uem A:8-111 [99267] Other proteins in same PDB: d1uema2, d1uema3 structural genomics; first Fn3 module |
PDB Entry: 1uem (more details)
SCOPe Domain Sequences for d1uema1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uema1 b.1.2.1 (A:8-111) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} knydlsdlpgppskpqvtdvtknsvtlswqpgtpgtlpasayiieafsqsvsnswqtvan hvkttlytvrglrpntiylfmvrainpqglsdpspmsdpvrtqd
Timeline for d1uema1: