Lineage for d1uelb_ (1uel B:)

  1. Root: SCOP 1.69
  2. 528313Class j: Peptides [58231] (116 folds)
  3. 529798Fold j.105: Ubiquitin interacting motif (UIM) [90302] (1 superfamily)
  4. 529799Superfamily j.105.1: Ubiquitin interacting motif (UIM) [90303] (1 family) (S)
  5. 529800Family j.105.1.1: Ubiquitin interacting motif (UIM) [90304] (2 proteins)
    amphipathic helix
  6. 529801Protein 26s proteasome non-ATPase regulatory subunit 4 (s5a) [103756] (1 species)
  7. 529802Species Human (Homo sapiens) [TaxId:9606] [103757] (3 PDB entries)
  8. 529803Domain d1uelb_: 1uel B: [99266]
    Other proteins in same PDB: d1uela_

Details for d1uelb_

PDB Entry: 1uel (more details)

PDB Description: solution structure of ubiquitin-like domain of hhr23b complexed with ubiquitin-interacting motif of proteasome subunit s5a

SCOP Domain Sequences for d1uelb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uelb_ j.105.1.1 (B:) 26s proteasome non-ATPase regulatory subunit 4 (s5a) {Human (Homo sapiens)}
gshmtisqqefgrtglpdlssmteeeqiayamqmslqgaefgqaesad

SCOP Domain Coordinates for d1uelb_:

Click to download the PDB-style file with coordinates for d1uelb_.
(The format of our PDB-style files is described here.)

Timeline for d1uelb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1uela_