SCOPe 2.06: Domain d1uela1: 1uel A:1-87

Lineage for d1uela1 (1uel A:1-87)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein Ubiquitin-like domain of Rad23 homolog B (Hhr23B) [102777] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102778] (2 PDB entries)
   Uniprot P54727 1-82

8. Domain d1uela1: 1uel A:1-87 [99265]
   Other proteins in same PDB: d1uela2, d1uelb1, d1uelb2
   complexed with the C-terminal ubiquitin-interacting motif of the proteasome subunit s5a

Details for d1uela1

PDB Entry: 1uel

PDB Description: solution structure of ubiquitin-like domain of hhr23b complexed with ubiquitin-interacting motif of proteasome subunit s5a

PDB Compounds: (A:) UV excision repair protein RAD23 homolog B

SCOPe Domain Sequences for d1uela1:

Sequence; same for both SEQRES and ATOM records:

>d1uela1 d.15.1.1 (A:1-87) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]}
mqvtlktlqqqtfkididpeetvkalkekiesekgkdafpvagqkliyagkilnddtalk
eykideknfvvvmvtkpkavstpapat

Timeline for d1uela1:

• d1uela1 first appeared in SCOP 1.67, called d1uela_
  
• d1uela1 was called d1uela_ in SCOPe 2.05
  
• d1uela1 appears in SCOPe 2.07
  
• d1uela1 appears in the current release, SCOPe 2.08