Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.6: Phosphoribulokinase/pantothenate kinase [52584] (6 proteins) |
Protein Uridine-cytidine kinase 2 [102360] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [102361] (6 PDB entries) |
Domain d1uejb_: 1uej B: [99264] complexed with cit, ctn |
PDB Entry: 1uej (more details), 2.61 Å
SCOPe Domain Sequences for d1uejb_:
Sequence, based on SEQRES records: (download)
>d1uejb_ c.37.1.6 (B:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} gepfligvsggtasgkssvcakivqllgqnevdyrqkqvvilsqdsfyrvltseqkakal kgqfnfdhpdafdnelilktlkeitegktvqipvydfvshsrkeetvtvypadvvlfegi lafysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdleqilsqyitfvkpafeefc lptkkyadviiprgadnlvainlivqhiqdiln
>d1uejb_ c.37.1.6 (B:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} gepfligvsggtasgkssvcakivqllgqqkqvvilsqdsfyrvltseqkakalkgqfnf dhpdafdnelilktlkeitegktvqipvydfvshsrkeetvtvypadvvlfegilafysq evrdlfqmklfvdtdadtrlsrrvlrdisergrdleqilsqyitfvkpafeefclptkky adviiprgadnlvainlivqhiqdiln
Timeline for d1uejb_: