SCOPe 2.06: Domain d1uehb_: 1ueh B:

Lineage for d1uehb_ (1ueh B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156

4. Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families)
   the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase

5. Family c.101.1.1: Undecaprenyl diphosphate synthase [64006] (2 proteins)
   automatically mapped to Pfam PF01255

6. Protein Undecaprenyl diphosphate synthase [64007] (3 species)

7. Species Escherichia coli [TaxId:562] [64009] (16 PDB entries)

8. Domain d1uehb_: 1ueh B: [99260]
   complexed with mg, oxn, so4, unl

Details for d1uehb_

PDB Entry: 1ueh, 1.73 Å

PDB Description: E. coli undecaprenyl pyrophosphate synthase in complex with Triton X-100, magnesium and sulfate

PDB Compounds: (B:) undecaprenyl pyrophosphate synthase

SCOPe Domain Sequences for d1uehb_:

Sequence; same for both SEQRES and ATOM records:

>d1uehb_ c.101.1.1 (B:) Undecaprenyl diphosphate synthase {Escherichia coli [TaxId: 562]}
gcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafssenwn
rpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntg
ltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtg
gehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanrer

Timeline for d1uehb_:

• d1uehb_ first appeared in SCOP 1.67
  
• d1uehb_ appears in SCOPe 2.05
  
• d1uehb_ appears in SCOPe 2.07
  
• d1uehb_ appears in the current release, SCOPe 2.08