SCOP 1.71: Domain d1uehb_: 1ueh B:

Lineage for d1uehb_ (1ueh B:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156

4. Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (1 family)
   the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase

5. Family c.101.1.1: Undecaprenyl diphosphate synthase [64006] (1 protein)

6. Protein Undecaprenyl diphosphate synthase [64007] (2 species)

7. Species Escherichia coli [TaxId:562] [64009] (3 PDB entries)

8. Domain d1uehb_: 1ueh B: [99260]
   complexed with mo4, oxn, so4

Details for d1uehb_

PDB Entry: 1ueh, 1.73 Å

PDB Description: E. coli undecaprenyl pyrophosphate synthase in complex with Triton X-100, magnesium and sulfate

SCOP Domain Sequences for d1uehb_:

Sequence; same for both SEQRES and ATOM records:

>d1uehb_ c.101.1.1 (B:) Undecaprenyl diphosphate synthase {Escherichia coli}
gcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafssenwn
rpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntg
ltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtg
gehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanrer

Timeline for d1uehb_:

• d1uehb_ first appeared in SCOP 1.67
  
• d1uehb_ appears in SCOP 1.69
  
• d1uehb_ appears in SCOP 1.73
  
• d1uehb_ appears in the current release, SCOPe 2.08