Lineage for d1uehb_ (1ueh B:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 404336Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156
  4. 404337Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (1 family) (S)
    the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase
  5. 404338Family c.101.1.1: Undecaprenyl diphosphate synthase [64006] (1 protein)
  6. 404339Protein Undecaprenyl diphosphate synthase [64007] (2 species)
  7. 404340Species Escherichia coli [TaxId:562] [64009] (3 PDB entries)
  8. 404342Domain d1uehb_: 1ueh B: [99260]
    complexed with mo4, oxn, so4

Details for d1uehb_

PDB Entry: 1ueh (more details), 1.73 Å

PDB Description: E. coli undecaprenyl pyrophosphate synthase in complex with Triton X-100, magnesium and sulfate

SCOP Domain Sequences for d1uehb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uehb_ c.101.1.1 (B:) Undecaprenyl diphosphate synthase {Escherichia coli}
gcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafssenwn
rpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntg
ltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtg
gehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanrer

SCOP Domain Coordinates for d1uehb_:

Click to download the PDB-style file with coordinates for d1uehb_.
(The format of our PDB-style files is described here.)

Timeline for d1uehb_: