SCOP 1.73: Domain d1ueha_: 1ueh A:

Lineage for d1ueha_ (1ueh A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156

4. Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (1 family)
   the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase

5. Family c.101.1.1: Undecaprenyl diphosphate synthase [64006] (1 protein)

6. Protein Undecaprenyl diphosphate synthase [64007] (2 species)

7. Species Escherichia coli [TaxId:562] [64009] (10 PDB entries)

8. Domain d1ueha_: 1ueh A: [99259]

Details for d1ueha_

PDB Entry: 1ueh, 1.73 Å

PDB Description: E. coli undecaprenyl pyrophosphate synthase in complex with Triton X-100, magnesium and sulfate

PDB Compounds: (A:) undecaprenyl pyrophosphate synthase

SCOP Domain Sequences for d1ueha_:

Sequence, based on SEQRES records:

>d1ueha_ c.101.1.1 (A:) Undecaprenyl diphosphate synthase {Escherichia coli [TaxId: 562]}
lpahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafss
enwnrpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealta
gntgltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlv
irtggehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanre

Sequence, based on observed residues (ATOM records):

>d1ueha_ c.101.1.1 (A:) Undecaprenyl diphosphate synthase {Escherichia coli [TaxId: 562]}
lpahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafsm
elfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntgltlniaanyg
grwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtggehrisnfll
wqiayaelyftdvlwpdfdeqdfegalnafanre

Timeline for d1ueha_:

• d1ueha_ first appeared in SCOP 1.67
  
• d1ueha_ appears in SCOP 1.71
  
• d1ueha_ appears in SCOP 1.75
  
• d1ueha_ appears in the current release, SCOPe 2.08