SCOP 1.67: Domain d1uega_: 1ueg A:

Lineage for d1uega_ (1ueg A:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.40: CH domain-like [47575] (2 superfamilies)
   core: 4 helices: bundle

4. Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (1 family)

5. Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (8 proteins)

6. Protein Microtubule-associated protein eb1, N-terminal microtubule binding domain [101194] (1 species)
   member of rp/eb family

7. Species Human (Homo sapiens) [TaxId:9606] [101195] (2 PDB entries)

8. Domain d1uega_: 1ueg A: [99258]
   complexed with so4

Details for d1uega_

PDB Entry: 1ueg, 2.4 Å

PDB Description: Crystal structure of amino-terminal microtubule binding domain of EB1

SCOP Domain Sequences for d1uega_:

Sequence, based on SEQRES records:

>d1uega_ a.40.1.1 (A:) Microtubule-associated protein eb1, N-terminal microtubule binding domain {Human (Homo sapiens)}
avnvystsvtsdnlsrhdmlawineslqlnltkieqlcsgaaycqfmdmlfpgsialkkv
kfqakleheyiqnfkilqagfkrmgvdkiipvdklvkgkfqdnfefvqwfkkffdanydg
kdydpvaar

Sequence, based on observed residues (ATOM records):

>d1uega_ a.40.1.1 (A:) Microtubule-associated protein eb1, N-terminal microtubule binding domain {Human (Homo sapiens)}
avnvysnlsrhdmlawineslqlnltkieqlcsgaaycqfmdmlfpgsialkkvkfqakl
eheyiqnfkilqagfkrmgvdkiipvdklvkgkfqdnfefvqwfkkffdanydgkvaar

Timeline for d1uega_:

• d1uega_ is new in SCOP 1.67
  
• d1uega_ appears in SCOP 1.69
  
• d1uega_ appears in the current release, SCOPe 2.08