Lineage for d1ueda_ (1ued A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 359341Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 359342Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 359343Family a.104.1.1: Cytochrome P450 [48265] (19 proteins)
  6. 359519Protein p450 monoxygenase OxyC [101371] (1 species)
    implicated in an oxidative C-C coupling reaction during vancomycin biosynthesis
  7. 359520Species Amycolatopsis orientalis [TaxId:31958] [101372] (1 PDB entry)
  8. 359521Domain d1ueda_: 1ued A: [99256]

Details for d1ueda_

PDB Entry: 1ued (more details), 1.9 Å

PDB Description: Crystal Structure of OxyC a Cytochrome P450 Implicated in an Oxidative C-C Coupling Reaction During Vancomycin Biosynthesis.

SCOP Domain Sequences for d1ueda_:

Sequence, based on SEQRES records: (download)

>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis}
didqvapllrepanfqlrtncdphednfglrahgplvrivgesstqlgrdfvwqahgyev
vrrilgdhehfttrpqftqsksgahveaqfvgqistydppehtrlrkmltpeftvrrirr
mepaiqsliddrldlleaegpsadlqglfadpvgahalcellgiprddqrefvrrirrna
dlsrglkaraadsaafnryldnllarqradpddgllgmivrdhgdnvtdeelkglctali
lggvetvagmigfgvlalldnpgqiellfespekaervvnelvrylspvqapnprlaikd
vvidgqlikagdyvlcsilmanrdealtpdpdvldanraavsdvgfghgihycvgaalar
smlrmayqtlwrrfpglrlavpieevkyrsafvdcpdqvpvtw

Sequence, based on observed residues (ATOM records): (download)

>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis}
didqvapllrepanfqlrtncdphednfglrahgplvrivgesstqlgrdfvwqahgyev
vrrilgdhehfttrpqfeaqfvgqistydppehtrlrkmltpeftvrrirrmepaiqsli
ddrldlleaegpsadlqglfadpvgahalcellgiprddqrefvrrirrnarglkaraad
saafnryldnllarqradpddgllgmivrdhgdnvtdeelkglctalilggvetvagmig
fgvlalldnpgqiellfespekaervvnelvrylspvqapnprlaikdvvidgqlikagd
yvlcsilmanrdealtpdpdvldanraavsdvgfghgihycvgaalarsmlrmayqtlwr
rfpglrlavpieevkyrsafvdcpdqvpvtw

SCOP Domain Coordinates for d1ueda_:

Click to download the PDB-style file with coordinates for d1ueda_.
(The format of our PDB-style files is described here.)

Timeline for d1ueda_: