Lineage for d1ue7a_ (1ue7 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1788689Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1788761Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins)
    barrel, closed; n=5, S=10
  6. 1788854Protein ssDNA-binding protein [50264] (4 species)
  7. 1788887Species Mycobacterium tuberculosis [TaxId:1773] [101760] (4 PDB entries)
  8. 1788896Domain d1ue7a_: 1ue7 A: [99251]

Details for d1ue7a_

PDB Entry: 1ue7 (more details), 3.2 Å

PDB Description: Crystal structure of the single-stranded dna-binding protein from mycobacterium tuberculosis
PDB Compounds: (A:) Single-strand binding protein

SCOPe Domain Sequences for d1ue7a_:

Sequence, based on SEQRES records: (download)

>d1ue7a_ b.40.4.3 (A:) ssDNA-binding protein {Mycobacterium tuberculosis [TaxId: 1773]}
gdttitivgnltadpelrftpsgaavanftvastpriydrqtgewkdgealflrcniwre
aaenvaesltrgarvivsgrlkqrsfetregekrtvievevdeigpslryatakvnkasr
sg

Sequence, based on observed residues (ATOM records): (download)

>d1ue7a_ b.40.4.3 (A:) ssDNA-binding protein {Mycobacterium tuberculosis [TaxId: 1773]}
gdttitivgnltadpelrftpsgaavanftvastpriydrdgealflrcniwreaaenva
esltrgarvivsgrlkqrtvievevdeigpslryatakvnkasrsg

SCOPe Domain Coordinates for d1ue7a_:

Click to download the PDB-style file with coordinates for d1ue7a_.
(The format of our PDB-style files is described here.)

Timeline for d1ue7a_: