SCOP 1.73: Domain d1ue7a_: 1ue7 A:

Lineage for d1ue7a_ (1ue7 A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.40: OB-fold [50198] (12 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (12 proteins)
   barrel, closed; n=5, S=10

6. Protein ssDNA-binding protein [50264] (4 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [101760] (4 PDB entries)

8. Domain d1ue7a_: 1ue7 A: [99251]

Details for d1ue7a_

PDB Entry: 1ue7, 3.2 Å

PDB Description: Crystal structure of the single-stranded dna-binding protein from mycobacterium tuberculosis

PDB Compounds: (A:) Single-strand binding protein

SCOP Domain Sequences for d1ue7a_:

Sequence, based on SEQRES records:

>d1ue7a_ b.40.4.3 (A:) ssDNA-binding protein {Mycobacterium tuberculosis [TaxId: 1773]}
gdttitivgnltadpelrftpsgaavanftvastpriydrqtgewkdgealflrcniwre
aaenvaesltrgarvivsgrlkqrsfetregekrtvievevdeigpslryatakvnkasr
sg

Sequence, based on observed residues (ATOM records):

>d1ue7a_ b.40.4.3 (A:) ssDNA-binding protein {Mycobacterium tuberculosis [TaxId: 1773]}
gdttitivgnltadpelrftpsgaavanftvastpriydrdgealflrcniwreaaenva
esltrgarvivsgrlkqrtvievevdeigpslryatakvnkasrsg

Timeline for d1ue7a_:

• d1ue7a_ first appeared in SCOP 1.67
  
• d1ue7a_ appears in SCOP 1.71
  
• d1ue7a_ appears in SCOP 1.75
  
• d1ue7a_ appears in the current release, SCOPe 2.08