![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
![]() | Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins) barrel, closed; n=5, S=10 |
![]() | Protein ssDNA-binding protein [50264] (4 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [101760] (4 PDB entries) |
![]() | Domain d1ue6c_: 1ue6 C: [99249] has additional insertions and/or extensions that are not grouped together missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 1ue6 (more details), 2.7 Å
SCOPe Domain Sequences for d1ue6c_:
Sequence, based on SEQRES records: (download)
>d1ue6c_ b.40.4.3 (C:) ssDNA-binding protein {Mycobacterium tuberculosis [TaxId: 1773]} gdttitivgnltadpelrftpsgaavanftvastpriydrqtgewkdgealflrcniwre aaenvaesltrgarvivsgrlkqrsfetregekrtvievevdeigpslryatakvnkas
>d1ue6c_ b.40.4.3 (C:) ssDNA-binding protein {Mycobacterium tuberculosis [TaxId: 1773]} gdttitivgnltadpelrftpsgaavanftvastpealflrcniwreaaenvaesltrga rvivsgrlkqrsfetregekrtvievevdeigpslryatakvnkas
Timeline for d1ue6c_: