Lineage for d1ue6b_ (1ue6 B:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373898Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 374537Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) (S)
  5. 374604Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (10 proteins)
    barrel, closed; n=5, S=10
  6. 374676Protein ssDNA-binding protein [50264] (3 species)
  7. 374697Species Mycobacterium tuberculosis [TaxId:1773] [101760] (4 PDB entries)
  8. 374703Domain d1ue6b_: 1ue6 B: [99248]

Details for d1ue6b_

PDB Entry: 1ue6 (more details), 2.7 Å

PDB Description: Crystal structure of the single-stranded dna-binding protein from mycobacterium tuberculosis

SCOP Domain Sequences for d1ue6b_:

Sequence, based on SEQRES records: (download)

>d1ue6b_ b.40.4.3 (B:) ssDNA-binding protein {Mycobacterium tuberculosis}
gdttitivgnltadpelrftpsgaavanftvastpriydrqtgewkdgealflrcniwre
aaenvaesltrgarvivsgrlkqrsfetregekrtvievevdeigpslryatakvnkasr
sgg

Sequence, based on observed residues (ATOM records): (download)

>d1ue6b_ b.40.4.3 (B:) ssDNA-binding protein {Mycobacterium tuberculosis}
gdttitivgnltadpelrftpsgaavanftvastpriealflrcniwreaaenvaesltr
garvivsgrlkqrsfettvievevdeigpslryatakvnkasrsgg

SCOP Domain Coordinates for d1ue6b_:

Click to download the PDB-style file with coordinates for d1ue6b_.
(The format of our PDB-style files is described here.)

Timeline for d1ue6b_: