Lineage for d1ue6a_ (1ue6 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789342Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins)
    barrel, closed; n=5, S=10
  6. 2789438Protein ssDNA-binding protein [50264] (4 species)
  7. 2789471Species Mycobacterium tuberculosis [TaxId:1773] [101760] (4 PDB entries)
  8. 2789476Domain d1ue6a_: 1ue6 A: [99247]
    has additional insertions and/or extensions that are not grouped together
    missing some secondary structures that made up less than one-third of the common domain

Details for d1ue6a_

PDB Entry: 1ue6 (more details), 2.7 Å

PDB Description: Crystal structure of the single-stranded dna-binding protein from mycobacterium tuberculosis
PDB Compounds: (A:) Single-strand binding protein

SCOPe Domain Sequences for d1ue6a_:

Sequence, based on SEQRES records: (download)

>d1ue6a_ b.40.4.3 (A:) ssDNA-binding protein {Mycobacterium tuberculosis [TaxId: 1773]}
agdttitivgnltadpelrftpsgaavanftvastpriydrqtgewkdgealflrcniwr
eaaenvaesltrgarvivsgrlkqrsfetregekrtvievevdeigpslryatakvnkas
rs

Sequence, based on observed residues (ATOM records): (download)

>d1ue6a_ b.40.4.3 (A:) ssDNA-binding protein {Mycobacterium tuberculosis [TaxId: 1773]}
agdttitivgnltadpelrftpsgaavanftvastpriydrqwkdgealflrcniwreaa
envaesltrgarvivsgrlkqrstvievevdeigpslryatakvnkasrs

SCOPe Domain Coordinates for d1ue6a_:

Click to download the PDB-style file with coordinates for d1ue6a_.
(The format of our PDB-style files is described here.)

Timeline for d1ue6a_: