SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1ue5b_ (1ue5 B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2049950Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2051128Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2051200Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 protein domains)
    barrel, closed; n=5, S=10
  6. 2051293Protein ssDNA-binding protein [50264] (4 species)
  7. 2051326Species Mycobacterium tuberculosis [TaxId:1773] [101760] (4 PDB entries)
  8. 2051330Domain d1ue5b_: 1ue5 B: [99246]
    complexed with cd

Details for d1ue5b_

PDB Entry: 1ue5 (more details), 2.6 Å

PDB Description: Crystal structure of the single-stranded dna-binding protein from mycobacterium tuberculosis
PDB Compounds: (B:) Single-strand binding protein

SCOPe Domain Sequences for d1ue5b_:

Sequence, based on SEQRES records: (download)

>d1ue5b_ b.40.4.3 (B:) ssDNA-binding protein {Mycobacterium tuberculosis [TaxId: 1773]}
gdttitivgnltadpelrftpsgaavanftvastpriydrqtgewkdgealflrcniwre
aaenvaesltrgarvivsgrlkqrsfetregekrtvievevdeigpslryatakvnka

Sequence, based on observed residues (ATOM records): (download)

>d1ue5b_ b.40.4.3 (B:) ssDNA-binding protein {Mycobacterium tuberculosis [TaxId: 1773]}
gdttitivgnltadpelrftpsgaavanftvastpriydrqtewkdgealflrcniwrea
aenvaesltrgarvivsgrlkqrsrtvievevdeigpslryatakvnka

SCOPe Domain Coordinates for d1ue5b_:

Click to download the PDB-style file with coordinates for d1ue5b_.
(The format of our PDB-style files is described here.)

Timeline for d1ue5b_: