SCOPe 2.07: Domain d1ue1b_: 1ue1 B:

Lineage for d1ue1b_ (1ue1 B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins)
   barrel, closed; n=5, S=10

6. Protein ssDNA-binding protein [50264] (4 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [101760] (4 PDB entries)

8. Domain d1ue1b_: 1ue1 B: [99244]
   complexed with zn

Details for d1ue1b_

PDB Entry: 1ue1, 2.5 Å

PDB Description: Crystal structure of the single-stranded dna-binding protein from mycobacterium tuberculosis

PDB Compounds: (B:) Single-strand binding protein

SCOPe Domain Sequences for d1ue1b_:

Sequence, based on SEQRES records:

>d1ue1b_ b.40.4.3 (B:) ssDNA-binding protein {Mycobacterium tuberculosis [TaxId: 1773]}
agdttitivgnltadpelrftpsgaavanftvastpriydrqtgewkdgealflrcniwr
eaaenvaesltrgarvivsgrlkqrsfetregekrtvievevdeigpslryatakvnkas
rs

Sequence, based on observed residues (ATOM records):

>d1ue1b_ b.40.4.3 (B:) ssDNA-binding protein {Mycobacterium tuberculosis [TaxId: 1773]}
agdttitivgnltadpelrftpsgaavanftvastpriydrqtgewkdgealflrcniwr
eaaenvaesltrgarvivsgrlkqrsfetrkrtvievevdeigpslryatakvnkasrs

Timeline for d1ue1b_:

• d1ue1b_ first appeared in SCOP 1.67
  
• d1ue1b_ appears in SCOPe 2.06
  
• d1ue1b_ appears in the current release, SCOPe 2.08