SCOP 1.67: Domain d1ue1a_: 1ue1 A:

Lineage for d1ue1a_ (1ue1 A:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.40: OB-fold [50198] (10 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (10 proteins)
   barrel, closed; n=5, S=10

6. Protein ssDNA-binding protein [50264] (3 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [101760] (4 PDB entries)

8. Domain d1ue1a_: 1ue1 A: [99243]

Details for d1ue1a_

PDB Entry: 1ue1, 2.5 Å

PDB Description: Crystal structure of the single-stranded dna-binding protein from mycobacterium tuberculosis

SCOP Domain Sequences for d1ue1a_:

Sequence, based on SEQRES records:

>d1ue1a_ b.40.4.3 (A:) ssDNA-binding protein {Mycobacterium tuberculosis}
gdttitivgnltadpelrftpsgaavanftvastpriydrqtgewkdgealflrcniwre
aaenvaesltrgarvivsgrlkqrsfetregekrtvievevdeigpslryatakvnka

Sequence, based on observed residues (ATOM records):

>d1ue1a_ b.40.4.3 (A:) ssDNA-binding protein {Mycobacterium tuberculosis}
gdttitivgnltadpelrftpsgaavanftvastpriydwkdgealflrcniwreaaenv
aesltrgarvivsgrlkqrsfetregekrtvievevdeigpslryatakvnka

Timeline for d1ue1a_:

• d1ue1a_ is new in SCOP 1.67
  
• d1ue1a_ appears in SCOP 1.69
  
• d1ue1a_ appears in the current release, SCOPe 2.08