Lineage for d1ue0b_ (1ue0 B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1550355Fold b.51: ValRS/IleRS/LeuRS editing domain [50676] (1 superfamily)
    core: barrel, closed; n=6, S=8; topology is similar to that of the acid proteases barrel
  4. 1550356Superfamily b.51.1: ValRS/IleRS/LeuRS editing domain [50677] (1 family) (S)
  5. 1550357Family b.51.1.1: ValRS/IleRS/LeuRS editing domain [50678] (4 proteins)
    inserted into the catalytic domain
  6. 1550358Protein Isoleucyl-tRNA synthetase (IleRS) [50679] (2 species)
  7. 1550363Species Thermus thermophilus [TaxId:274] [50680] (6 PDB entries)
  8. 1550369Domain d1ue0b_: 1ue0 B: [99242]
    isolated (cp1) domain structure
    protein/RNA complex; complexed with val

Details for d1ue0b_

PDB Entry: 1ue0 (more details), 2 Å

PDB Description: isoleucyl-trna synthetase editing domain complexed with l-valine
PDB Compounds: (B:) isoleucyl-tRNA synthetase

SCOPe Domain Sequences for d1ue0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ue0b_ b.51.1.1 (B:) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus [TaxId: 274]}
dpsvyvrfplkepkklglekaslliwtttpwtlpgnvaaavhpeytyaafqvgdealile
eglgrkllgegtqvlktfpgkaleglpytppypqalekgyfvvladyvsqedgtgivhqa
pafgaedletarvyglpllktvdeegkllvepfkglyfreanrailrdlrgrgflfkees

SCOPe Domain Coordinates for d1ue0b_:

Click to download the PDB-style file with coordinates for d1ue0b_.
(The format of our PDB-style files is described here.)

Timeline for d1ue0b_: