SCOP 1.75: Domain d1ue0b_: 1ue0 B:

Lineage for d1ue0b_ (1ue0 B:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.51: ValRS/IleRS/LeuRS editing domain [50676] (1 superfamily)
   core: barrel, closed; n=6, S=8; topology is similar to that of the acid proteases barrel

4. Superfamily b.51.1: ValRS/IleRS/LeuRS editing domain [50677] (1 family)

5. Family b.51.1.1: ValRS/IleRS/LeuRS editing domain [50678] (3 proteins)
   inserted into the catalytic domain

6. Protein Isoleucyl-tRNA synthetase (IleRS) [50679] (2 species)

7. Species Thermus thermophilus [TaxId:274] [50680] (5 PDB entries)

8. Domain d1ue0b_: 1ue0 B: [99242]
   isolated (cp1) domain structure
   complexed with val

Details for d1ue0b_

PDB Entry: 1ue0, 2 Å

PDB Description: isoleucyl-trna synthetase editing domain complexed with l-valine

PDB Compounds: (B:) isoleucyl-tRNA synthetase

SCOP Domain Sequences for d1ue0b_:

Sequence; same for both SEQRES and ATOM records:

>d1ue0b_ b.51.1.1 (B:) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus [TaxId: 274]}
dpsvyvrfplkepkklglekaslliwtttpwtlpgnvaaavhpeytyaafqvgdealile
eglgrkllgegtqvlktfpgkaleglpytppypqalekgyfvvladyvsqedgtgivhqa
pafgaedletarvyglpllktvdeegkllvepfkglyfreanrailrdlrgrgflfkees

Timeline for d1ue0b_:

• d1ue0b_ first appeared in SCOP 1.67
  
• d1ue0b_ appears in SCOP 1.73
  
• d1ue0b_ appears in SCOPe 2.01
  
• d1ue0b_ appears in the current release, SCOPe 2.08