Class b: All beta proteins [48724] (144 folds) |
Fold b.51: ValRS/IleRS/LeuRS editing domain [50676] (1 superfamily) core: barrel, closed; n=6, S=8; topology is similar to that of the acid proteases barrel |
Superfamily b.51.1: ValRS/IleRS/LeuRS editing domain [50677] (1 family) |
Family b.51.1.1: ValRS/IleRS/LeuRS editing domain [50678] (3 proteins) inserted into the catalytic domain |
Protein Isoleucyl-tRNA synthetase (IleRS) [50679] (2 species) |
Species Thermus thermophilus [TaxId:274] [50680] (5 PDB entries) |
Domain d1ue0a_: 1ue0 A: [99241] |
PDB Entry: 1ue0 (more details), 2 Å
SCOP Domain Sequences for d1ue0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ue0a_ b.51.1.1 (A:) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus} qdpsvyvrfplkepkklglekaslliwtttpwtlpgnvaaavhpeytyaafqvgdealil eeglgrkllgegtqvlktfpgkaleglpytppypqalekgyfvvladyvsqedgtgivhq apafgaedletarvyglpllktvdeegkllvepfkglyfreanrailrdlrgrgflfkee s
Timeline for d1ue0a_: