Lineage for d1ue0a_ (1ue0 A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 377961Fold b.51: ValRS/IleRS/LeuRS editing domain [50676] (1 superfamily)
    core: barrel, closed; n=6, S=8; topology is similar to that of the acid proteases barrel
  4. 377962Superfamily b.51.1: ValRS/IleRS/LeuRS editing domain [50677] (1 family) (S)
  5. 377963Family b.51.1.1: ValRS/IleRS/LeuRS editing domain [50678] (3 proteins)
    inserted into the catalytic domain
  6. 377964Protein Isoleucyl-tRNA synthetase (IleRS) [50679] (2 species)
  7. 377969Species Thermus thermophilus [TaxId:274] [50680] (5 PDB entries)
  8. 377972Domain d1ue0a_: 1ue0 A: [99241]

Details for d1ue0a_

PDB Entry: 1ue0 (more details), 2 Å

PDB Description: isoleucyl-trna synthetase editing domain complexed with l-valine

SCOP Domain Sequences for d1ue0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ue0a_ b.51.1.1 (A:) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus}
qdpsvyvrfplkepkklglekaslliwtttpwtlpgnvaaavhpeytyaafqvgdealil
eeglgrkllgegtqvlktfpgkaleglpytppypqalekgyfvvladyvsqedgtgivhq
apafgaedletarvyglpllktvdeegkllvepfkglyfreanrailrdlrgrgflfkee
s

SCOP Domain Coordinates for d1ue0a_:

Click to download the PDB-style file with coordinates for d1ue0a_.
(The format of our PDB-style files is described here.)

Timeline for d1ue0a_: