Lineage for d1udzb_ (1udz B:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 467114Fold b.51: ValRS/IleRS/LeuRS editing domain [50676] (1 superfamily)
    core: barrel, closed; n=6, S=8; topology is similar to that of the acid proteases barrel
  4. 467115Superfamily b.51.1: ValRS/IleRS/LeuRS editing domain [50677] (1 family) (S)
  5. 467116Family b.51.1.1: ValRS/IleRS/LeuRS editing domain [50678] (3 proteins)
    inserted into the catalytic domain
  6. 467117Protein Isoleucyl-tRNA synthetase (IleRS) [50679] (2 species)
  7. 467122Species Thermus thermophilus [TaxId:274] [50680] (5 PDB entries)
  8. 467124Domain d1udzb_: 1udz B: [99240]
    isolated (cp1) domain structure

Details for d1udzb_

PDB Entry: 1udz (more details), 1.8 Å

PDB Description: isoleucyl-trna synthetase editing domain

SCOP Domain Sequences for d1udzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1udzb_ b.51.1.1 (B:) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus}
psvyvrfplkepkklglekaslliwtttpwtlpgnvaaavhpeytyaafqvgdealilee
glgrkllgegtpvlktfpgkaleglpytppypqalekgyfvvladyvsqedgtgivhqap
afgaedletarvyglpllktvdeegkllvepfkglyfreanrailrdlrgrgflfkees

SCOP Domain Coordinates for d1udzb_:

Click to download the PDB-style file with coordinates for d1udzb_.
(The format of our PDB-style files is described here.)

Timeline for d1udzb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1udza_