Lineage for d1udza_ (1udz A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1322965Fold b.51: ValRS/IleRS/LeuRS editing domain [50676] (1 superfamily)
    core: barrel, closed; n=6, S=8; topology is similar to that of the acid proteases barrel
  4. 1322966Superfamily b.51.1: ValRS/IleRS/LeuRS editing domain [50677] (1 family) (S)
  5. 1322967Family b.51.1.1: ValRS/IleRS/LeuRS editing domain [50678] (4 proteins)
    inserted into the catalytic domain
  6. 1322968Protein Isoleucyl-tRNA synthetase (IleRS) [50679] (2 species)
  7. 1322973Species Thermus thermophilus [TaxId:274] [50680] (6 PDB entries)
  8. 1322976Domain d1udza_: 1udz A: [99239]
    isolated (cp1) domain structure

Details for d1udza_

PDB Entry: 1udz (more details), 1.8 Å

PDB Description: isoleucyl-trna synthetase editing domain
PDB Compounds: (A:) isoleucyl-tRNA synthetase

SCOPe Domain Sequences for d1udza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1udza_ b.51.1.1 (A:) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus [TaxId: 274]}
psvyvrfplkepkklglekaslliwtttpwtlpgnvaaavhpeytyaafqvgdealilee
glgrkllgegtpvlktfpgkaleglpytppypqalekgyfvvladyvsqedgtgivhqap
afgaedletarvyglpllktvdeegkllvepfkglyfreanrailrdlrgrgflfkees

SCOPe Domain Coordinates for d1udza_:

Click to download the PDB-style file with coordinates for d1udza_.
(The format of our PDB-style files is described here.)

Timeline for d1udza_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1udzb_