SCOP 1.67: Domain d1udza_: 1udz A:

Lineage for d1udza_ (1udz A:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.51: ValRS/IleRS/LeuRS editing domain [50676] (1 superfamily)
   core: barrel, closed; n=6, S=8; topology is similar to that of the acid proteases barrel

4. Superfamily b.51.1: ValRS/IleRS/LeuRS editing domain [50677] (1 family)

5. Family b.51.1.1: ValRS/IleRS/LeuRS editing domain [50678] (3 proteins)
   inserted into the catalytic domain

6. Protein Isoleucyl-tRNA synthetase (IleRS) [50679] (2 species)

7. Species Thermus thermophilus [TaxId:274] [50680] (5 PDB entries)

8. Domain d1udza_: 1udz A: [99239]

Details for d1udza_

PDB Entry: 1udz, 1.8 Å

PDB Description: isoleucyl-trna synthetase editing domain

SCOP Domain Sequences for d1udza_:

Sequence; same for both SEQRES and ATOM records:

>d1udza_ b.51.1.1 (A:) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus}
psvyvrfplkepkklglekaslliwtttpwtlpgnvaaavhpeytyaafqvgdealilee
glgrkllgegtpvlktfpgkaleglpytppypqalekgyfvvladyvsqedgtgivhqap
afgaedletarvyglpllktvdeegkllvepfkglyfreanrailrdlrgrgflfkees

Timeline for d1udza_:

• d1udza_ is new in SCOP 1.67
  
• d1udza_ appears in SCOP 1.69
  
• d1udza_ appears in the current release, SCOPe 2.08