Lineage for d1udyd2 (1udy D:11-241)

  1. Root: SCOP 1.73
  2. 742018Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)
  3. 742756Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 742757Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (2 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 742758Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (9 proteins)
  6. 742798Protein Medium chain acyl-CoA dehydrogenase, NM domains [56649] (3 species)
  7. 742820Species Pig (Sus scrofa) [TaxId:9823] [56650] (3 PDB entries)
  8. 742828Domain d1udyd2: 1udy D:11-241 [99238]
    Other proteins in same PDB: d1udya1, d1udyb1, d1udyc1, d1udyd1
    complexed with cs8, fad

Details for d1udyd2

PDB Entry: 1udy (more details), 2.4 Å

PDB Description: Medium-Chain Acyl-CoA Dehydrogenase with 3-Thiaoctanoyl-CoA
PDB Compounds: (D:) Acyl-CoA dehydrogenase, medium-chain specific

SCOP Domain Sequences for d1udyd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1udyd2 e.6.1.1 (D:11-241) Medium chain acyl-CoA dehydrogenase, NM domains {Pig (Sus scrofa) [TaxId: 9823]}
gfsfelteqqkefqatarkfareeiipvaaeydrtgeypvpllkrawelglmnthipesf
gglglgiidscliteelaygctgvqtaieantlgqvpliiggnyqqqkkylgrmteeplm
caycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkapa
skaftgfiveadtpgvqigrkeinmgqrcsdtrgivfedvrvpkenvltge

SCOP Domain Coordinates for d1udyd2:

Click to download the PDB-style file with coordinates for d1udyd2.
(The format of our PDB-style files is described here.)

Timeline for d1udyd2: