Lineage for d1udxa3 (1udx A:341-416)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 423400Fold d.242: Obg GTP-binding protein C-terminal domain [102740] (1 superfamily)
    beta-(2)-alpha(3)-beta(2); 2 layers: beta/alpha; mixed beta-sheet: order 1234; strands 2 and 3 a parallel to each other
  4. 423401Superfamily d.242.1: Obg GTP-binding protein C-terminal domain [102741] (1 family) (S)
  5. 423402Family d.242.1.1: Obg GTP-binding protein C-terminal domain [102742] (1 protein)
  6. 423403Protein Obg GTP-binding protein C-terminal domain [102743] (1 species)
  7. 423404Species Thermus thermophilus [TaxId:274] [102744] (1 PDB entry)
    TT1381
  8. 423405Domain d1udxa3: 1udx A:341-416 [99230]
    Other proteins in same PDB: d1udxa1, d1udxa2
    complexed with act, mpd

Details for d1udxa3

PDB Entry: 1udx (more details), 2.07 Å

PDB Description: Crystal structure of the conserved protein TT1381 from Thermus thermophilus HB8

SCOP Domain Sequences for d1udxa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1udxa3 d.242.1.1 (A:341-416) Obg GTP-binding protein C-terminal domain {Thermus thermophilus}
qagvevvpvaegvyevrapeverylarikgdlmeaagylqevfrrqgveaalrakgvrag
dlvrigglefeyipev

SCOP Domain Coordinates for d1udxa3:

Click to download the PDB-style file with coordinates for d1udxa3.
(The format of our PDB-style files is described here.)

Timeline for d1udxa3: