Lineage for d1udwb_ (1udw B:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393331Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 393332Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 393709Family c.37.1.6: Phosphoribulokinase/pantothenate kinase [52584] (5 protein domains)
  6. 393729Protein Uridine-cytidine kinase 2 [102360] (1 species)
  7. 393730Species Human (Homo sapiens) [TaxId:9606] [102361] (5 PDB entries)
  8. 393736Domain d1udwb_: 1udw B: [99227]
    complexed with ctp

Details for d1udwb_

PDB Entry: 1udw (more details), 2.6 Å

PDB Description: Crystal structure of human uridine-cytidine kinase 2 complexed with a feedback-inhibitor, CTP

SCOP Domain Sequences for d1udwb_:

Sequence, based on SEQRES records: (download)

>d1udwb_ c.37.1.6 (B:) Uridine-cytidine kinase 2 {Human (Homo sapiens)}
epfligvsggtasgkssvcakivqllgqnevdyrqkqvvilsqdsfyrvltseqkakalk
gqfnfdhpdafdnelilktlkeitegktvqipvydfvshsrkeetvtvypadvvlfegil
afysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdleqilsqyitfvkpafeefcl
ptkkyadviiprgadnlvainlivqhiqdilng

Sequence, based on observed residues (ATOM records): (download)

>d1udwb_ c.37.1.6 (B:) Uridine-cytidine kinase 2 {Human (Homo sapiens)}
epfligvsggtasgkssvcakivqllgqyrqkqvvilsqdsfyrvltseqkakalkgqfn
fdhpdafdnelilktlkeitegktvqipvydfvshsrkeetvtvypadvvlfegilafys
qevrdlfqmklfvdtdadtrlsrrvlrdisergrdleqilsqyitfvkpafeefclptkk
yadviiprgadnlvainlivqhiqdilng

SCOP Domain Coordinates for d1udwb_:

Click to download the PDB-style file with coordinates for d1udwb_.
(The format of our PDB-style files is described here.)

Timeline for d1udwb_: