Lineage for d1udvb_ (1udv B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1031026Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 1031227Superfamily d.68.6: AlbA-like [82704] (3 families) (S)
  5. 1031228Family d.68.6.1: DNA-binding protein AlbA [82705] (2 proteins)
  6. 1031229Protein DNA-binding protein AlbA [82706] (4 species)
    an archaeal chromatin protein modulated by acetylation, a Sir2 substrate
  7. 1031240Species Sulfolobus solfataricus, Sso10b2 [TaxId:2287] [103058] (3 PDB entries)
    gene SSO6877 (AlbA2)
  8. 1031244Domain d1udvb_: 1udv B: [99225]
    complexed with zn

Details for d1udvb_

PDB Entry: 1udv (more details), 1.85 Å

PDB Description: Crystal structure of the hyperthermophilic archaeal dna-binding protein Sso10b2 at 1.85 A
PDB Compounds: (B:) DNA binding protein sso10b

SCOPe Domain Sequences for d1udvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1udvb_ d.68.6.1 (B:) DNA-binding protein AlbA {Sulfolobus solfataricus, Sso10b2 [TaxId: 2287]}
klneivvrktknvedhvldvivlfnqgidevilkgtgreiskavdvynslkdrlgdgvql
vnvqtgsevrdrrrisyillrlkrvy

SCOPe Domain Coordinates for d1udvb_:

Click to download the PDB-style file with coordinates for d1udvb_.
(The format of our PDB-style files is described here.)

Timeline for d1udvb_: