SCOP 1.69: Domain d1udvb_: 1udv B:

Lineage for d1udvb_ (1udv B:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.68: IF3-like [55199] (7 superfamilies)
   beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest

4. Superfamily d.68.6: AlbA-like [82704] (2 families)

5. Family d.68.6.1: DNA-binding protein AlbA [82705] (1 protein)

6. Protein DNA-binding protein AlbA [82706] (4 species)
   an archaeal chromatin protein modulated by acetylation, a Sir2 substrate

7. Species Archaeon Sulfolobus solfataricus, Sso10b2 [TaxId:2287] [103058] (1 PDB entry)
   gene SSO6877 (AlbA2)

8. Domain d1udvb_: 1udv B: [99225]

Details for d1udvb_

PDB Entry: 1udv, 1.85 Å

PDB Description: Crystal structure of the hyperthermophilic archaeal dna-binding protein Sso10b2 at 1.85 A

SCOP Domain Sequences for d1udvb_:

Sequence; same for both SEQRES and ATOM records:

>d1udvb_ d.68.6.1 (B:) DNA-binding protein AlbA {Archaeon Sulfolobus solfataricus, Sso10b2}
klneivvrktknvedhvldvivlfnqgidevilkgtgreiskavdvynslkdrlgdgvql
vnvqtgsevrdrrrisyillrlkrvy

Timeline for d1udvb_:

• d1udvb_ first appeared in SCOP 1.67
  
• d1udvb_ appears in SCOP 1.71
  
• d1udvb_ appears in the current release, SCOPe 2.08