Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily) beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134 |
Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (1 family) |
Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (10 proteins) |
Protein Ribonuclease PH, domain 2 [103150] (3 species) |
Species Aquifex aeolicus [TaxId:63363] [103151] (4 PDB entries) |
Domain d1udsa2: 1uds A:151-255 [99220] Other proteins in same PDB: d1udsa1 complexed with po4, so4; mutant |
PDB Entry: 1uds (more details), 2.3 Å
SCOPe Domain Sequences for d1udsa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1udsa2 d.101.1.1 (A:151-255) Ribonuclease PH, domain 2 {Aquifex aeolicus [TaxId: 63363]} eetpikdfvaavsvgivndrilldlnfeedsaaqvdmnvvgtgsgrlsevhtmgeeysft kdelikmldlaqkginelielqkklyviqdgkwerselkevsstt
Timeline for d1udsa2: