SCOPe 2.05: Domain d1udqa2: 1udq A:151-255

Lineage for d1udqa2 (1udq A:151-255)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134

4. Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families)

5. Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (11 proteins)

6. Protein Ribonuclease PH, domain 2 [103150] (4 species)

7. Species Aquifex aeolicus [TaxId:63363] [103151] (4 PDB entries)

8. Domain d1udqa2: 1udq A:151-255 [99218]
   Other proteins in same PDB: d1udqa1
   complexed with po4, so4; mutant

Details for d1udqa2

PDB Entry: 1udq, 2.3 Å

PDB Description: crystal structure of the trna processing enzyme rnase ph t125a mutant from aquifex aeolicus

PDB Compounds: (A:) Ribonuclease PH

SCOPe Domain Sequences for d1udqa2:

Sequence; same for both SEQRES and ATOM records:

>d1udqa2 d.101.1.1 (A:151-255) Ribonuclease PH, domain 2 {Aquifex aeolicus [TaxId: 63363]}
eetpikdfvaavsvgivndrilldlnfeedsaaqvdmnvvgtgsgrlsevhtmgeeysft
kdelikmldlaqkginelielqkklyviqdgkwerselkevsstt

Timeline for d1udqa2:

• d1udqa2 first appeared in SCOP 1.67
  
• d1udqa2 appears in SCOPe 2.04
  
• d1udqa2 appears in SCOPe 2.06
  
• d1udqa2 appears in the current release, SCOPe 2.08