Lineage for d1udqa2 (1udq A:151-255)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967341Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134
  4. 2967342Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) (S)
  5. 2967343Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (11 proteins)
  6. 2967461Protein Ribonuclease PH, domain 2 [103150] (4 species)
  7. 2967462Species Aquifex aeolicus [TaxId:63363] [103151] (4 PDB entries)
  8. 2967465Domain d1udqa2: 1udq A:151-255 [99218]
    Other proteins in same PDB: d1udqa1
    complexed with po4, so4; mutant

Details for d1udqa2

PDB Entry: 1udq (more details), 2.3 Å

PDB Description: crystal structure of the trna processing enzyme rnase ph t125a mutant from aquifex aeolicus
PDB Compounds: (A:) Ribonuclease PH

SCOPe Domain Sequences for d1udqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1udqa2 d.101.1.1 (A:151-255) Ribonuclease PH, domain 2 {Aquifex aeolicus [TaxId: 63363]}
eetpikdfvaavsvgivndrilldlnfeedsaaqvdmnvvgtgsgrlsevhtmgeeysft
kdelikmldlaqkginelielqkklyviqdgkwerselkevsstt

SCOPe Domain Coordinates for d1udqa2:

Click to download the PDB-style file with coordinates for d1udqa2.
(The format of our PDB-style files is described here.)

Timeline for d1udqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1udqa1