![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
![]() | Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (11 proteins) |
![]() | Protein Ribonuclease PH, domain 1 [102758] (4 species) |
![]() | Species Aquifex aeolicus [TaxId:63363] [102759] (4 PDB entries) |
![]() | Domain d1udqa1: 1udq A:2-150 [99217] Other proteins in same PDB: d1udqa2 complexed with po4, so4; mutant |
PDB Entry: 1udq (more details), 2.3 Å
SCOPe Domain Sequences for d1udqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1udqa1 d.14.1.4 (A:2-150) Ribonuclease PH, domain 1 {Aquifex aeolicus [TaxId: 63363]} rsdgrkedqlrpvsiqrdfleypegsclisfgktkvictasvienvpnwlkgkgqgwita eysmlpratqqrtiresvqgriggrtheiqrmigramrtaveltkigertiwvdcdviqa dggartaaitgafvavadaiiklhkegii
Timeline for d1udqa1: