![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily) beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134 |
![]() | Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (1 family) ![]() |
![]() | Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (2 proteins) |
![]() | Protein Ribonuclease PH, domain 2 [103150] (3 species) |
![]() | Species Aquifex aeolicus [TaxId:63363] [103151] (4 PDB entries) |
![]() | Domain d1udoa2: 1udo A:151-255 [99216] Other proteins in same PDB: d1udoa1 complexed with po4, so4; mutant |
PDB Entry: 1udo (more details), 2.3 Å
SCOP Domain Sequences for d1udoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1udoa2 d.101.1.1 (A:151-255) Ribonuclease PH, domain 2 {Aquifex aeolicus} eetpikdfvaavsvgivndrilldlnfeedsaaqvdmnvvgtgsgrlsevhtmgeeysft kdelikmldlaqkginelielqkklyviqdgkwerselkevsstt
Timeline for d1udoa2: