Lineage for d1udoa2 (1udo A:151-255)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 416561Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134
  4. 416562Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (1 family) (S)
  5. 416563Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (2 proteins)
  6. 416570Protein Ribonuclease PH, domain 2 [103150] (3 species)
  7. 416571Species Aquifex aeolicus [TaxId:63363] [103151] (4 PDB entries)
  8. 416573Domain d1udoa2: 1udo A:151-255 [99216]
    Other proteins in same PDB: d1udoa1
    complexed with po4, so4; mutant

Details for d1udoa2

PDB Entry: 1udo (more details), 2.3 Å

PDB Description: crystal structure of the trna processing enzyme rnase ph r86a mutant from aquifex aeolicus

SCOP Domain Sequences for d1udoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1udoa2 d.101.1.1 (A:151-255) Ribonuclease PH, domain 2 {Aquifex aeolicus}
eetpikdfvaavsvgivndrilldlnfeedsaaqvdmnvvgtgsgrlsevhtmgeeysft
kdelikmldlaqkginelielqkklyviqdgkwerselkevsstt

SCOP Domain Coordinates for d1udoa2:

Click to download the PDB-style file with coordinates for d1udoa2.
(The format of our PDB-style files is described here.)

Timeline for d1udoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1udoa1