Lineage for d1udoa2 (1udo A:151-255)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134
  4. Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) (S)
  5. Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (11 proteins)
  6. Protein Ribonuclease PH, domain 2 [103150] (4 species)
  7. Species Aquifex aeolicus [TaxId:63363] [103151] (4 PDB entries)
  8. Domain d1udoa2: 1udo A:151-255 [99216]
    Other proteins in same PDB: d1udoa1
    complexed with po4, so4; mutant

Details for d1udoa2

PDB Entry: 1udo (more details), 2.3 Å

PDB Description: Crystal structure of the tRNA processing enzyme RNase PH R86A mutant from Aquifex aeolicus
PDB Compounds: (A:) Ribonuclease PH

SCOPe Domain Sequences for d1udoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1udoa2 d.101.1.1 (A:151-255) Ribonuclease PH, domain 2 {Aquifex aeolicus [TaxId: 63363]}
eetpikdfvaavsvgivndrilldlnfeedsaaqvdmnvvgtgsgrlsevhtmgeeysft
kdelikmldlaqkginelielqkklyviqdgkwerselkevsstt

SCOPe Domain Coordinates for d1udoa2 are not available.

Timeline for d1udoa2:

Domains from same chain:
(mouse over for more information)
d1udoa1