Lineage for d1udna2 (1udn A:151-255)
- Root: SCOP 1.69
Class d: Alpha and beta proteins (a+b) [53931] (279 folds) 
Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (1 family) 
Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (2 proteins) Protein Ribonuclease PH, domain 2 [103150] (3 species) 
Species Aquifex aeolicus [TaxId:63363] [103151] (4 PDB entries) 
Domain d1udna2: 1udn A:151-255 [99214]
Other proteins in same PDB: d1udna1
Details for d1udna2
PDB Entry: 1udn (more details), 2.3 Å
PDB Description: Crystal structure of the tRNA processing enzyme RNase PH from Aquifex aeolicus
SCOP Domain Sequences for d1udna2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1udna2 d.101.1.1 (A:151-255) Ribonuclease PH, domain 2 {Aquifex aeolicus}
eetpikdfvaavsvgivndrilldlnfeedsaaqvdmnvvgtgsgrlsevhtmgeeysft
kdelikmldlaqkginelielqkklyviqdgkwerselkevsstt
SCOP Domain Coordinates for d1udna2:
Click to download the PDB-style file with coordinates for d1udna2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1udna2:
- d1udna2 first appeared in SCOP 1.67
- d1udna2 appears in SCOP 1.71
- d1udna2 appears in the current release, SCOPe 2.08
View in 3D
