Lineage for d1udka_ (1udk A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2636719Superfamily g.3.14: Elafin-like [57256] (2 families) (S)
    automatically mapped to Pfam PF00095
  5. 2636720Family g.3.14.1: Elafin-like [57257] (3 proteins)
  6. 2636725Protein Nawaprin [103563] (1 species)
  7. 2636726Species Spitting cobra (Naja nigricollis) [TaxId:8654] [103564] (1 PDB entry)
  8. 2636727Domain d1udka_: 1udk A: [99211]

Details for d1udka_

PDB Entry: 1udk (more details)

PDB Description: solution structure of nawaprin
PDB Compounds: (A:) Nawaprin

SCOPe Domain Sequences for d1udka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1udka_ g.3.14.1 (A:) Nawaprin {Spitting cobra (Naja nigricollis) [TaxId: 8654]}
neksgscpdmsmpipplgicktlcnsdsgcpnvqkcckngcgfmtcttpvp

SCOPe Domain Coordinates for d1udka_:

Click to download the PDB-style file with coordinates for d1udka_.
(The format of our PDB-style files is described here.)

Timeline for d1udka_: