Lineage for d1udea_ (1ude A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373898Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 375047Superfamily b.40.5: Inorganic pyrophosphatase [50324] (1 family) (S)
  5. 375048Family b.40.5.1: Inorganic pyrophosphatase [50325] (1 protein)
    barrel, closed; n=5, S=8
  6. 375049Protein Inorganic pyrophosphatase [50326] (5 species)
    eukaryotic enzyme has additional secondary structures at both N- and C-termini
  7. 375050Species Archaeon Pyrococcus horikoshii [TaxId:53953] [101771] (1 PDB entry)
  8. 375051Domain d1udea_: 1ude A: [99208]

Details for d1udea_

PDB Entry: 1ude (more details), 2.66 Å

PDB Description: Crystal structure of the Inorganic pyrophosphatase from the hyperthermophilic archaeon Pyrococcus horikoshii OT3

SCOP Domain Sequences for d1udea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1udea_ b.40.5.1 (A:) Inorganic pyrophosphatase {Archaeon Pyrococcus horikoshii}
fhdlepgpnvpevvyalieipkgsrnkyeldketgllkldrvlytpfhypvdygiiprtw
yedgdpfdimvimreptypltiiearpiglfkmidsgdkdykvlavpvedpyfkdwkdis
dvpkafldeiahffkrykelegkeiivegwegaeaakreilraiemyk

SCOP Domain Coordinates for d1udea_:

Click to download the PDB-style file with coordinates for d1udea_.
(The format of our PDB-style files is described here.)

Timeline for d1udea_: