Class b: All beta proteins [48724] (141 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (12 families) |
Family b.82.1.2: Germin/Seed storage 7S protein [51187] (4 proteins) |
Protein Seed storage 7S protein [51188] (5 species) duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer |
Species Soybean (Glycine max), proglycinin [TaxId:3847] [69345] (3 PDB entries) |
Domain d1ud1b2: 1ud1 B:297-470 [99205] |
PDB Entry: 1ud1 (more details), 3.1 Å
SCOP Domain Sequences for d1ud1b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ud1b2 b.82.1.2 (B:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin} ictmrlrhnigqtsspdiynpqagsvttatsldfpalswlrlsaefgslrknamfvphyn lnansiiyalngraliqvvncngervfdgelqegrvlivpqnfvvaarsqsdnfeyvsfk tndtpmigtlagansllnalpeeviqhtfnlksqqarqiknnnpfkflvppqes
Timeline for d1ud1b2:
View in 3D Domains from other chains: (mouse over for more information) d1ud1a1, d1ud1a2, d1ud1c1, d1ud1c2 |