SCOP 1.67: Domain d1ud1b2: 1ud1 B:297-470

Lineage for d1ud1b2 (1ud1 B:297-470)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (12 families)

5. Family b.82.1.2: Germin/Seed storage 7S protein [51187] (4 proteins)

6. Protein Seed storage 7S protein [51188] (5 species)
   duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer

7. Species Soybean (Glycine max), proglycinin [TaxId:3847] [69345] (3 PDB entries)

8. Domain d1ud1b2: 1ud1 B:297-470 [99205]

Details for d1ud1b2

PDB Entry: 1ud1, 3.1 Å

PDB Description: crystal structure of proglycinin mutant c88s

SCOP Domain Sequences for d1ud1b2:

Sequence; same for both SEQRES and ATOM records:

>d1ud1b2 b.82.1.2 (B:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin}
ictmrlrhnigqtsspdiynpqagsvttatsldfpalswlrlsaefgslrknamfvphyn
lnansiiyalngraliqvvncngervfdgelqegrvlivpqnfvvaarsqsdnfeyvsfk
tndtpmigtlagansllnalpeeviqhtfnlksqqarqiknnnpfkflvppqes

Timeline for d1ud1b2:

• d1ud1b2 is new in SCOP 1.67
  
• d1ud1b2 appears in SCOP 1.69
  
• d1ud1b2 appears in the current release, SCOPe 2.08