SCOP 1.73: Domain d1ud1b1: 1ud1 B:10-248

Lineage for d1ud1b1 (1ud1 B:10-248)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (20 families)

5. Family b.82.1.2: Germin/Seed storage 7S protein [51187] (4 proteins)

6. Protein Seed storage 7S protein [51188] (6 species)
   duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer

7. Species Soybean (Glycine max), proglycinin [TaxId:3847] [69345] (3 PDB entries)

8. Domain d1ud1b1: 1ud1 B:10-248 [99204]

Details for d1ud1b1

PDB Entry: 1ud1, 3.1 Å

PDB Description: crystal structure of proglycinin mutant c88s

PDB Compounds: (B:) glycinin g1

SCOP Domain Sequences for d1ud1b1:

Sequence, based on SEQRES records:

>d1ud1b1 b.82.1.2 (B:10-248) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]}
necqiqklnalkpdnriesegglietwnpnnkpfqcagvalsrctlnrnalrrpsytngp
qeiyiqqgkgifgmiypgspstfeepqqpqqrgqssrpqdrhqkiynfregdliavptgv
awwmynnedtpvvavsiidtnslenqldqmprrfylagnqeqeflkyqqeqgghqsqkgk
hqqeeeneggsilsgftleflehafsvdkqiaknlqgenegedkgaivtvkgglsvikp

Sequence, based on observed residues (ATOM records):

>d1ud1b1 b.82.1.2 (B:10-248) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]}
necqiqklnalkpdnriesegglietwnpnnkpfqcagvalsrctlnrnalrrpsytngp
qeiyiqqgkgifgmiyprhqkiynfregdliavptgvawwmynnedtpvvavsiidtnsl
enqldqmprrfylagnqeqeflkyqqggsilsgftleflehafsvdkqiaknlqgekgai
vtvkgglsvikp

Timeline for d1ud1b1:

• d1ud1b1 first appeared in SCOP 1.67
  
• d1ud1b1 appears in SCOP 1.71
  
• d1ud1b1 appears in SCOP 1.75
  
• d1ud1b1 appears in the current release, SCOPe 2.08