Lineage for d1ud0c_ (1ud0 C:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 439808Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (7 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 439871Superfamily a.8.4: Heat shock protein 70kD (HSP70), C-terminal subdomain [100934] (1 family) (S)
  5. 439872Family a.8.4.1: Heat shock protein 70kD (HSP70), C-terminal subdomain [100935] (1 protein)
  6. 439873Protein DnaK [100936] (2 species)
  7. 439879Species Rat (Rattus norvegicus) [TaxId:10116] [101098] (1 PDB entry)
  8. 439882Domain d1ud0c_: 1ud0 C: [99200]

Details for d1ud0c_

PDB Entry: 1ud0 (more details), 3.45 Å

PDB Description: crystal structure of the c-terminal 10-kda subdomain of hsc70

SCOP Domain Sequences for d1ud0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ud0c_ a.8.4.1 (C:) DnaK {Rat (Rattus norvegicus)}
lvprgshmlesyafnmkatvedeklqgkindedkqkildkcneiiswldknqtaekeefe
hqqkelekvcnpiitklyqsaggmpggm

SCOP Domain Coordinates for d1ud0c_:

Click to download the PDB-style file with coordinates for d1ud0c_.
(The format of our PDB-style files is described here.)

Timeline for d1ud0c_: