Class a: All alpha proteins [46456] (218 folds) |
Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (7 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
Superfamily a.8.4: Heat shock protein 70kD (HSP70), C-terminal subdomain [100934] (1 family) |
Family a.8.4.1: Heat shock protein 70kD (HSP70), C-terminal subdomain [100935] (1 protein) |
Protein DnaK [100936] (2 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [101098] (1 PDB entry) |
Domain d1ud0c_: 1ud0 C: [99200] |
PDB Entry: 1ud0 (more details), 3.45 Å
SCOP Domain Sequences for d1ud0c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ud0c_ a.8.4.1 (C:) DnaK {Rat (Rattus norvegicus)} lvprgshmlesyafnmkatvedeklqgkindedkqkildkcneiiswldknqtaekeefe hqqkelekvcnpiitklyqsaggmpggm
Timeline for d1ud0c_: