![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
![]() | Superfamily a.8.4: Heat shock protein 70kD (HSP70), C-terminal subdomain [100934] (1 family) ![]() |
![]() | Family a.8.4.1: Heat shock protein 70kD (HSP70), C-terminal subdomain [100935] (3 proteins) |
![]() | Protein DnaK [100936] (2 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [101098] (1 PDB entry) |
![]() | Domain d1ud0b_: 1ud0 B: [99199] C-terminal subdomain only; forms helix-swapped dimer complexed with na |
PDB Entry: 1ud0 (more details), 3.45 Å
SCOPe Domain Sequences for d1ud0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ud0b_ a.8.4.1 (B:) DnaK {Norway rat (Rattus norvegicus) [TaxId: 10116]} rgshmlesyafnmkatvedeklqgkindedkqkildkcneiiswldknqtaekeefehqq kelekvcnpiitklyqsaggmp
Timeline for d1ud0b_: