Lineage for d1ud0b_ (1ud0 B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1261719Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 1261863Superfamily a.8.4: Heat shock protein 70kD (HSP70), C-terminal subdomain [100934] (1 family) (S)
  5. 1261864Family a.8.4.1: Heat shock protein 70kD (HSP70), C-terminal subdomain [100935] (3 proteins)
  6. 1261868Protein DnaK [100936] (2 species)
  7. 1261874Species Norway rat (Rattus norvegicus) [TaxId:10116] [101098] (1 PDB entry)
  8. 1261876Domain d1ud0b_: 1ud0 B: [99199]
    C-terminal subdomain only; forms helix-swapped dimer
    complexed with na

Details for d1ud0b_

PDB Entry: 1ud0 (more details), 3.45 Å

PDB Description: crystal structure of the c-terminal 10-kda subdomain of hsc70
PDB Compounds: (B:) 70 kDa heat-shock-like protein

SCOPe Domain Sequences for d1ud0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ud0b_ a.8.4.1 (B:) DnaK {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rgshmlesyafnmkatvedeklqgkindedkqkildkcneiiswldknqtaekeefehqq
kelekvcnpiitklyqsaggmp

SCOPe Domain Coordinates for d1ud0b_:

Click to download the PDB-style file with coordinates for d1ud0b_.
(The format of our PDB-style files is described here.)

Timeline for d1ud0b_: