Lineage for d1ud0b_ (1ud0 B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 534682Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (8 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 534753Superfamily a.8.4: Heat shock protein 70kD (HSP70), C-terminal subdomain [100934] (1 family) (S)
  5. 534754Family a.8.4.1: Heat shock protein 70kD (HSP70), C-terminal subdomain [100935] (2 proteins)
  6. 534758Protein DnaK [100936] (2 species)
  7. 534764Species Rat (Rattus norvegicus) [TaxId:10116] [101098] (1 PDB entry)
  8. 534766Domain d1ud0b_: 1ud0 B: [99199]

Details for d1ud0b_

PDB Entry: 1ud0 (more details), 3.45 Å

PDB Description: crystal structure of the c-terminal 10-kda subdomain of hsc70

SCOP Domain Sequences for d1ud0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ud0b_ a.8.4.1 (B:) DnaK {Rat (Rattus norvegicus)}
rgshmlesyafnmkatvedeklqgkindedkqkildkcneiiswldknqtaekeefehqq
kelekvcnpiitklyqsaggmp

SCOP Domain Coordinates for d1ud0b_:

Click to download the PDB-style file with coordinates for d1ud0b_.
(The format of our PDB-style files is described here.)

Timeline for d1ud0b_: