SCOPe 2.08: Domain d1ud0b1: 1ud0 B:542-618

Lineage for d1ud0b1 (1ud0 B:542-618)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.4: Heat shock protein 70kD (HSP70), C-terminal subdomain [100934] (2 families)

5. Family a.8.4.1: Heat shock protein 70kD (HSP70), C-terminal subdomain [100935] (3 proteins)

6. Protein DnaK [100936] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [101098] (1 PDB entry)

8. Domain d1ud0b1: 1ud0 B:542-618 [99199]
   Other proteins in same PDB: d1ud0a2, d1ud0b2, d1ud0c2, d1ud0d2
   C-terminal subdomain only; forms helix-swapped dimer
   complexed with na
   fragment; missing more than one-third of the common structure and/or sequence

Details for d1ud0b1

PDB Entry: 1ud0, 3.45 Å

PDB Description: crystal structure of the c-terminal 10-kda subdomain of hsc70

PDB Compounds: (B:) 70 kDa heat-shock-like protein

SCOPe Domain Sequences for d1ud0b1:

Sequence; same for both SEQRES and ATOM records:

>d1ud0b1 a.8.4.1 (B:542-618) DnaK {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lesyafnmkatvedeklqgkindedkqkildkcneiiswldknqtaekeefehqqkelek
vcnpiitklyqsaggmp

Timeline for d1ud0b1:

• d1ud0b1 first appeared in SCOP 1.67, called d1ud0b_
  
• d1ud0b1 appears in SCOPe 2.07