SCOP 1.73: Domain d1ud0a_: 1ud0 A:

Lineage for d1ud0a_ (1ud0 A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (10 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.4: Heat shock protein 70kD (HSP70), C-terminal subdomain [100934] (1 family)

5. Family a.8.4.1: Heat shock protein 70kD (HSP70), C-terminal subdomain [100935] (2 proteins)

6. Protein DnaK [100936] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [101098] (1 PDB entry)

8. Domain d1ud0a_: 1ud0 A: [99198]

Details for d1ud0a_

PDB Entry: 1ud0, 3.45 Å

PDB Description: crystal structure of the c-terminal 10-kda subdomain of hsc70

PDB Compounds: (A:) 70 kDa heat-shock-like protein

SCOP Domain Sequences for d1ud0a_:

Sequence; same for both SEQRES and ATOM records:

>d1ud0a_ a.8.4.1 (A:) DnaK {Rat (Rattus norvegicus) [TaxId: 10116]}
rgshmlesyafnmkatvedeklqgkindedkqkildkcneiiswldknqtaekeefehqq
kelekvcnpiitklyqsaggmpgg

Timeline for d1ud0a_:

• d1ud0a_ first appeared in SCOP 1.67
  
• d1ud0a_ appears in SCOP 1.71
  
• d1ud0a_ appears in SCOP 1.75
  
• d1ud0a_ appears in the current release, SCOPe 2.08, called d1ud0a1