Lineage for d1ucxc1 (1ucx C:14-248)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2080271Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2080272Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2080350Family b.82.1.2: Germin/Seed storage 7S protein [51187] (5 proteins)
  6. 2080374Protein Seed storage 7S protein [51188] (6 species)
    duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer
  7. 2080446Species Soybean (Glycine max), proglycinin [TaxId:3847] [69345] (3 PDB entries)
  8. 2080457Domain d1ucxc1: 1ucx C:14-248 [99196]
    mutant

Details for d1ucxc1

PDB Entry: 1ucx (more details), 3.2 Å

PDB Description: crystal structure of proglycinin c12g mutant
PDB Compounds: (C:) glycinin g1

SCOPe Domain Sequences for d1ucxc1:

Sequence, based on SEQRES records: (download)

>d1ucxc1 b.82.1.2 (C:14-248) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]}
iqklnalkpdnriesegglietwnpnnkpfqcagvalsrctlnrnalrrpsytngpqeiy
iqqgkgifgmiypgcpstfeepqqpqqrgqssrpqdrhqkiynfregdliavptgvawwm
ynnedtpvvavsiidtnslenqldqmprrfylagnqeqeflkyqqeqgghqsqkgkhqqe
eeneggsilsgftleflehafsvdkqiaknlqgenegedkgaivtvkgglsvikp

Sequence, based on observed residues (ATOM records): (download)

>d1ucxc1 b.82.1.2 (C:14-248) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]}
iqklnalkpdnriesegglietwnpnnkpfqcagvalsrctlnrnalrrpsytngpqeiy
iqqgkgifgmiypgcpstrhqkiynfregdliavptgvawwmynnedtpvvavsiidtns
lenqldqmprrfylagnqeqeflkyqqggsilsgftleflehafsvdkqiaknlqgekga
ivtvkgglsvikp

SCOPe Domain Coordinates for d1ucxc1:

Click to download the PDB-style file with coordinates for d1ucxc1.
(The format of our PDB-style files is described here.)

Timeline for d1ucxc1: