![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) ![]() |
![]() | Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins) |
![]() | Protein Ephrin type-A receptor 8, C-terminal domain [101242] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [101243] (1 PDB entry) |
![]() | Domain d1ucva1: 1ucv A:8-75 [99191] Other proteins in same PDB: d1ucva2, d1ucva3 |
PDB Entry: 1ucv (more details)
SCOPe Domain Sequences for d1ucva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ucva1 a.60.1.2 (A:8-75) Ephrin type-A receptor 8, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} ltvgdwldsirmgryrdhfaaggysslgmvlrmnaqdvralgitlmghqkkilgsiqtmr aqltstqg
Timeline for d1ucva1: